PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c3_12080V3.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 330aa    MW: 37547.3 Da    PI: 10.8607
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c3_12080V3.3.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.13.7e-172267147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                       rg W +eEde l ++v ++G+ +W++Ia+++  gR++k+c++rw++ 
  Pp3c3_12080V3.3.p 22 RGHWRPEEDENLRKLVSRFGPQNWNLIAQKLH-GRSGKSCRLRWFNQ 67
                       899*****************************.***********996 PP

2Myb_DNA-binding55.21.6e-1774118147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        r ++T +E+e+l+ a++ +G++ W+ Iar ++ gRt++ +k++w+ +
  Pp3c3_12080V3.3.p  74 RRPFTDDEEERLLAAHRFHGNK-WAMIARLFP-GRTDNAVKNHWHVV 118
                        679*******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.6991768IPR017930Myb domain
SMARTSM007171.1E-132170IPR001005SANT/Myb domain
SuperFamilySSF466898.99E-2921115IPR009057Homeodomain-like
PfamPF002491.6E-162267IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-262375IPR009057Homeodomain-like
CDDcd001677.12E-132566No hitNo description
PROSITE profilePS5129425.09369123IPR017930Myb domain
SMARTSM007172.5E-1473121IPR001005SANT/Myb domain
PfamPF002491.6E-1374117IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-2076122IPR009057Homeodomain-like
CDDcd001674.22E-1176119No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MDHKTSGKDI MYCAGQSKKC PRGHWRPEED ENLRKLVSRF GPQNWNLIAQ KLHGRSGKSC  60
RLRWFNQLDP RINRRPFTDD EEERLLAAHR FHGNKWAMIA RLFPGRTDNA VKNHWHVVMA  120
RKFREHLRYS DFERTQAPRR GIRPRPSPCY HVSSPKAWIV KNARGISNGE LQDASPALQY  180
LHRPLTPSRN TTNFPVSITS SVQSVFTFPE TSGSVHDLST NSHSPRDLAQ ASMYDLTDTH  240
LSTGFKDKSV DRAPAQITKS FSAREEQAEG RRTRVTADPC GHTVVNPSTS IHHHRRQECK  300
SCYRLRTRSS SRKGAPTASF IDFLGVGAI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-31221237108B-MYB
1h88_C1e-302212358159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-302212358159MYB PROTO-ONCOGENE PROTEIN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S74_264V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.12e-62myb domain protein 105